In the realm of biochemical research, the study of specific protein fragments is essential for understanding fundamental biological mechanisms. My personal exploration into the abeta 1 42 peptide sequence has provided deep insights into the structural complexity of this 42-amino-acid chain. As someone who frequently works with high-purity laboratory reagents, I have found that grasping the specific arrangement of these residues is critical when evaluating any recombinant peptide Beta-Amyloid 1-4 β-Amyloid (1-42), human (E-PP-0428) 2 utilized in experimental workflows.
The Primary Structure of Aβ42
The primary amino aci Amyloid b Protein Fragment 1-42 107761-42-2 - Sigma-Aldrich d sequence of the 42-amino-acid Aβ isoform Aβ42 is a well-documented subject in structural biology. The sequence is represented by the one-letter code: DAEFRHDSGYEVHHQKLVFFAED Sequence (1-letter):DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OHStorage: -20 °C or below. Solubility: 1 mg/mL in 50 mM Tris or dissolve 1 mg in 70-80 uL 1 Read more VGSNKGAIIGLMVGGVVIA. When broken down into its three-letter components, the Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu chain reveals the specific chemical nature of this peptide.
For researchers focu amyloid β 1-42 peptide; β-Amyloid Peptide (1-42), Human · PP69 · β-Amyloid Peptide (1-42), Human ; β-Amyloid Peptide (1-42), Rat.Read more sing on the technical specifications, the full {ASP}{ALA}{GLU}{PHE}{ARG}{HIS}{ASP}{SER}{GLY}{TYR}{GLU}{VAL} segment represents the N-terminal region. This molecule, often cataloged under 1 and 42, carries a molecular weight of approximately 4514 g/mol. Whether you are sourcing human Beta-Amyloid 1-42 sequence data for computational modeling or physical laboratory use, the consistency of this DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH structure is the gold standard for quality control.
Structural Observations and Aggregation Characteristics
My experience with beta-Amyloid Peptide (1-42) has taught me that the environment—such as the use of HFIP treatment—drastically affects the initial state of the material. Scientific literature, specifically regarding the two helical regions encompassing residues 8-25 and 28-38, highlights how this amyloid β 1-42 peptide transitions between states.
When comparing the wild-type, human Aβ1-42 peptide against a Aβ (1-42), Scrambled control, the importance of sequence integrity becomes obvious. The scrambled version, which serves as a vital negative control, lacks the characteristic aggregation profile of the native Aβ42 form. Furthermore, the use of beta-Amyloid (1-42), FAM-labeled variants has been incredibly useful in my own visual tracking experiments, allowing for a clearer observation of how these molecules behave in controlled environments.
Technical Considerations for Handling
When handling Human beta Amyloid (1-42) PTD Recombinant Protein or standard variants, I adhere strictly to storage protocols. Most high-quality preparations require storage at -20°C or below to maintain the structural integrity of the Aβ(1-42 chain.
Key takeaways for those integrating this Beta Amyloid into their research:
* Sequence Verification: Always confirm the DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAII Amyloid β-peptide (1-42) (rat/mouse)) GLMVGGVVIA string against the provided Certificate of Analysis.
* Purity: Ensure that the product is verified by Mass Spectrometry, as impurities can significantly skew data regarding the is a human form of the predominant amyloid β-peptide.
* Preparation: Solubility is a common hurdle. Utilizing buffers like 50 mM Tris is often necessary to achieve a stable 1 mg/mL concentration.
By maintaining a rigorous focus on the sequence and the biochemical properties of this specific peptide, researchers can ensure that their experimental results are both reproducible and sci Amyloid β-Protein (1-42) - Bachem Products entifically sound. Whether you are investigating the conformational shifts or the biophysical interactions of the amyloid β 1-42 β-Amyloid (1-42), human TFA (Synonyms: Amyloid β-peptide (1-42) (human) TFA) ; Sequence Shortening.DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA; Shipping. Room Read more peptide, the precision of your starting material remains the most critical factor in your success.