In the specialized field of neuroscience and protein chemistry, the study of the amyloid beta 1 40 sequenc Aβ(1–40) forms five distinct amyloid structures whose β-sheet ecatalog peptides is foundational. As someone who frequently navigates the complex requirements of sourcing high-quality, reliable reagents for laboratory investigation, I have found that understanding the nuances of these peptide structures is essential for achieving consistent experimental results.
The Structural Identity of Amyloid Beta 1-40
The amyloid beta (Aβ) protein is a primary focus in protein misfolding research. Specifically, the 40-residue peptide known as Aβ(1–40) serves as a critical benchmark. When reviewing the Catalog entries for these materials, researchers often encounter the specific sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV.
This sequence represents the amino acids 1 to 40 fragment of the human protein. It is important to distinguish this from other variants, as Aβ(1–40) and Aβ(1–42) are the two major C-terminal variants of the Aβ family. While they share a high degree of homology, their physiological behaviors—particularly their aggregation kinetics—differ significantly.
Technical Specifications and Quality Assurance
When selecting an Amyloid reagent, precision is paramount. The technical data for Amyloid β-Peptide (1-40) typically highlights a molecular weight of 4329.8 Da and a formula, C194H295N53O58S. For those requiring high purity, the beta-Amyloid (1-40), Ultra Pure, TFA form is often the standard choice.
In my experience, the preparation method is just as vital as the peptide itself. Many high-quality suppliers offer high quality recombinant Beta-Amyloid (1-40), HFIP treated versions. Using 1,1,1,3,3,3-hexafluoro-2-propanol (HFIP) is a standard protocol to ensure the peptide is initially monomeric, whic Aβ(1–40) forms five distinct amyloid structures whose β-sheet h is crucial for studies examining five structurally distinct fibrillar aggregates of the Alzheimer's plaque peptide Aβ(1–40).
Variability in Research Models
It is also worth noting the differences between species. While human Beta Amyloid is the primary interest, researchers also utilize the amino acids 1 to 40 fragment of mouse and rat beta-amyl Beta-amyloid is a40-43 amino acid peptidecleaved from amyloid precursor protein, and a putative gamma-secretase.Read more oid. These naturally occurring variations, which differ by three amino acid residues (at positions 5, 10, and 13), serve as vital controls in comparative studies.
Practical Considerations f Amyloid β-Peptide (1-40) (human) or the Lab
Whether you are performing NMR structural studies or testing inhibitory compounds, the consistency of your amyloid-beta peptide sequence is the variable that determines your success. I have found that sourcing from suppliers who allow for "custom synthesis" is often better for specific, high-stakes experiments where you need to define your own peptide purity and concentration parameters.
Ultimately, whether you are analyzing the β 1 segment or investigating the broader beta amyloid peptide landscape, the 1, 40 residues remain the "gold standard" for understanding protein-protein interactions in a controlled environment. By adhering to strict storage protocols—typically keeping the peptide lyophilized at -20°C or -80°C—one can ensure that the beta-amyloid remains stable for long-term catalog research applications.
Summary of Key Data
* Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
* Formula: C194H295N53O58S
* Common Form: TFA (Trif β-Amyloid (1-42), human luoroacetic acid) salt
* Research Application: Often used as a molecular weight standard or in structural aggregation studies.
By focusing on the 40-43 amino acid peptide dynamics and ensuring that the A (amyloid) component is handled with technical rigor, researchers can continue to push the boundaries of biochemical scien Amyloid Beta-Peptide(1-40) (human) (CAS 131438-79-4) is a syntheticpeptidecomposed of40amino acids identical to residues1-40of humanamyloid-betaRead more ce with Beta Amyloid(1-40)Peptide(Human) TFA (CAS: 131438-79-4)(ab120479) isamajor constituent ofamyloidplaques and associated with Alzheimer disease. Molecular Read more out relying on anecdotal evidence, instead trusting the precise, verifiable nature of these synthetic peptides.