In the specialized field of neuroscience research, the amyloid beta 40 sequence serves as a cornerstone for investigating protein aggregation and the structural dynamics of neuro-pathological models. As someone deeply engaged in sourcing high-quality materials for laboratory inquiry, I have found that understanding the nuances of the peptide structure is essential for achieving reproducible results.
The Structural Profile of Amyloid Beta 40
The amyloid beta (1-40) molecule is a 40-residue amino acid chain. When looking through a peptide catalog, it is cr Findbeta amyloid peptide 1-40and related products for scientific research at MilliporeSigma. itical to verify the sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV. This specific arrangement of amino acids dictates how the molecule behaves in solution.
The formula, C194H295N53O58S, represents its molecular complexity. For those of us sourcing these materials, the te β-Amyloid (1-42), human chnical data for amyloid β-peptide (1-40) often highlights its status as a 40-residue peptide, which distinguishes it from its longer counterparts. It is widely recognized that Amyloid β-peptide (1-40) (human) is the predominant amyloid beta isoform used in experimental setups to study plaque formation.
Comparative Analysis and Variants
When evaluating research materials, one often encounters the two major C-terminal variants of the Aβ protein: the 1-40 and the 1-42 fragments. The amyloid beta 40 vs 42 distinction is vital because these variants exhi Amyloid beta 1-40 TFA [131438-79-4] Chemical Structure. Molecular Formula, C194H295N53O58S. Sequence (one letter),DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV. CAS Read more bit di Beta-Amyloid Peptide (1-40), mouse, rat fferent aggregation kinetics. While researchers frequently analyze the amyloid beta 40/42 ratio, I have observed that the 1-40 variant is particularly valued for its stability in specific buffered environments.
I often rely on beta-amyloid (1-40), ultra pure, TFA salt forms for my experiments. Purity is paramount; contaminants can significantly alter the five structurally distinct fibrillar aggregates of the Alzheimer's plaque peptide Aβ(1–40) that have been reported in literature.
Practical Considerations for Research
1. Preparation: Many researchers utilize 100% HFIP to dissolve the beta amyloid peptide 1-40 to ensure a monomeric state before starting aggregation assays.
2. Controls: beta-Amyloid (1-40), Ultra Pure, TFA[131438-79-4] ; Catalog Number · P000959 ; Sequence · Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val- Read more Using a scrambled β-amyloid (1-40) is a biological active peptide control is a best practice. This scrambled version helps confirm that observed effects are specific to the native amyloid sequence rather than non-specific interactions.
3. Species Specificity: It is important to note that the amino acids 1 to 40 fragment of mouse and rat beta-amyloid differs from the human sequence by three residues (Arg5, Tyr10, and His13). Always ensure your peptide matches the specific biological model you are studying.
Sourcing and Quality Assurance
When browsing a peptide catalog, the amyloid beta peptide price often reflects the synthesis method and the level of purification (e.g., HPLC-grade). Whether you are sourcing Beta Amyloid 1-40 (A Beta-Amyloid Peptide (1-40), mouse, rat from a vendor or looking for specific amyloid peptides, always request the certificate of analysis to confirm the mass spectrometry results.
The Aβ(1–40) molecule is highly sensitive to its environment. Factors such as pH, salt concentration, and temperature influence whether the a chain remains in a soluble oligomeric state or proceeds to form insoluble fibrillar assemblies. By maintaining rigorous control over the amyloid beta peptide sequence integrity, we ensure that our findings contribute accurately to the broader understanding of amyloid dynamics in non-clinical, fundamental research.