In the world of biochemistry and peptide research, few molecules draw as much fascination as the cathelicidin family. As someone who has spent considerable time reviewing literature and exploring the structural nuances of these molecules, I h by W Gao · 2015 · Cited by 63 — We identified a novel avian cathelicidin ortholog from ducks and named dCATH. The cDNA sequence of dCATH encodes a predicted 146-amino-acid polypeptide. ave found that understanding the cathelicidin peptide sequence is essential for anyone interested in how these biological components function.
The Foundation: LL-37 and Human Cathelicidin
When discussing this family, one must address human cath LL-37, the only human member of the cathelicidin family of elicidin LL-37. It is widely recognized that LL-37 is the only cathelicidin-derived polypeptide found in humans. This molecule is an antimicrobial protein that is an integral component of the innate immune system, serving as a primary defense mechanism.
The primary sequence is defined by 37 amino acids: [LL-37, 37 aa] When analyzing this chain, researchers often break it down into segments to study its order of residues. The sequence is frequently represented as LLGDF–FRKSK–EKIGK–EFKRI–VQRIK–DFLRN–LVPRT-ES. This amphipathic, helical structure is what allows it to interact effectively with biological membranes.
Comparative Analysis: Beyond Humans
My exploration into this field naturally led me to look at orthologs in other species. For instance, dCATH is a fascinating NCBI Taxonomy ID: 9606. Amino acid sequence: >lcl|BSEQ0013177|Cathelicidin antimicrobial peptide MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLD avian cathelicidin ortholog identified in ducks. Similarly, studies have characterized BMAP-271 and BMAP-28 (bovine myeloid antimicrobial peptides), which highlight the diversity of this family across mammals.
When conducting a deep dive into specific laboratory data, you might encounter references like SEQUENCE=P49913 or the lcl identifier, which are standard in protein databases. I have also examined two novel cathelicidin-like peptides—BotrAMP14 and Cro Cathelicidin antimicrobial peptide (human) | Protein Target tAMP—which further illustrate the evolutionary breadth of these sequences.
Structural Variations and Active Fragments
For those interested in the granular details, it is important to note that researchers have identified smaller, highly active versions of the full-length peptide. Specifically, Peptides KR-12, KR-11, KR-10, and RI-10 have been synthesized and studied for their specific properties. Furthermore, synthetic versions such as the 17 amino acids near the carboxy This peptide corresponds to 17 amino acids near the carboxy terminus of human Cathelicidin. PEP-0633 can be used as a blocking peptide with polyclonal antibody terminus of human Cathelicidin are often used in laboratory settings as analytical tools.
When working with commercial reagents, you may come across a recombinant protein corresponding to Gln31-Ser170, which is frequently supplied for structural studies. These tools allow for a more precise analysis of the exact amino acid and peptide sequence alignment, which is critical for understanding how these molecules bind to bacterial lipopolysaccharides (LPS).
Insights from Personal Research
The human cathelicidin peptide LL-37 remains the gold standard for study. Its ability to act as a peptide that bridges various immune functions is truly remarkable. While I am not a medical professional, my review of the cathelicidin literature emphasizes that these molecules are not just simple chains of amino acids; they are sophisticated, highly conserved structures.
Whether you are looking at the LLGDF–FRKSK–EKIGK–. EFKRI–VQRIK–DFLRN–LVPRT-ES motif or investigating the broader cathelicidin family, the complexity of these sequences is undeniable. By focusing on the structural by UHN Dürr · 1758 · Cited by 1367 — The primary structure of LL-37, LLGDF–FRKSK–EKIGK–. EFKRI–VQRIK–DFLRN–LVPRT-ES, was given along with other α-helical cathelicidin-derived antimicrobial peptides properties and the order of these residues, we gain a better appreciation for the roles these molecules play in nature's complex biological systems.