When sourcing raw materials for personal formulation projects or professional laboratory research, one of the most critical logistical hurdles is identifying the correct cosmetic peptide HS code. As a dedicated enthusiast of peptide synthesis and skincare ingredient science, I have learned that the Harmonized System (HS) code is not merely a number; it is a vital identifier that dictates regulatory compliance and import procedures.
The Significance of HS Codes in Peptide Sourcing
The cosmetic peptide sector is highly specialized. Whether you are dealing with a complex sequence like Tetrapeptide-30 (Molecular Formula: C22H41N7O6) or a common bioactive li 330499 - Canadian Importers Database (CID) ke Copper tripeptide (CAS 89030-95-5), the classification often depends on the product’s specific end-use and chemical purity.
In my experience, suppliers often categorize these materials under different chapters depending on their primary state. For instance, while researching imports, I frequently encounter HS Code 33049990 for beauty or make-up preparations. However, if the material is a highly purified research-grade compound intended for synthesis, you might find it listed under HS Code 38220090 (diagnostic or laboratory reagents).
Key Classifications to Monitor
* HS Code 29371900: Often utilized for specific hormonal or amino acid-based derivatives.
* ITC (HS) Code 35040010: Relevant when dealing with collagen peptides of marine, bovine, or poultry origin.
* HS Code 3504.00.5000: Frequently applied to specialized collagen peptide preparations.
* HS Code 34029099: Sometimes utilized for specific raw material mixtures used in cleansing, repairing, and moisturizing the skin.
Decoding the 6 Digits Universal HS Code
For international shipments, the 6 digits universal HS code serves as the foundation for global trade. Regardless of the destination country, these digits remain the standard. When I work with international vendors—such as those sourcing HY-D0187 (L-Glutathione reduced) or P002663 (Palmitoyl Hexapeptide)—I always verify the 6-digit prefix first. This ensures that the documentation aligns with the custom Cosmetic peptidesare small molecules of degraded collagen that contain amino acid groups and generally consist of 2-10 amino acids. s requiremen Custom Cosmetic Peptide Synthesis ts of the destination port.
Practical Considerations for Enthusiasts
If you are importing ingredients for personal study, you may encounter specific tariff classifications like 2 Find accurate Peptide HSN Code used in Canada from 0 options.HS Code 33059090is most popular, used in 7.2M+ export import shipments. 106.10.0000, HTSUS, which is sometimes assigned to food-grade preparations rather than cosmetic-grade raw materials. Navigating these categories requires diligence:
1. Verify the Grade: Is it Cosmetic Grade or analytical research grade? This distinction often dictates whether the item falls under 330499 (General Beauty Preparations) or a more technical chemical chapter.
2. Documentation: Always request a Certificate of Analysis (CoA) alongside the declaration. This helps customs officers confirm the chemical identity, such as the sequenc Peptide HSN Code used in Canada e of Acetyl Hexapeptide-8 (CAS 616204-22-9).
3. Specific Identifiers: Keep track of internal product codes like CP-01-13760 or RSC1036. These identifiers are helpful when communicating with suppliers like TAG Copenhagen or specialized manufacturers who assist with custom synthesis.
Personal Insights on Ingredient Integrity
My journey into the world of cosmetics and synthesis has taught me that the "va We at Lyotex are capable to provide a wide range of bioactivecosmetic peptidesand also advisory services regardingcosmeticformulation.Read more lue" of a peptide is not just in its sequence, but in its purity. When sourcing from platforms like America Suns Life, I prioritize transparency in the ingredient's origin. Whether it is peptide chains for skin-nourishing applications or compounds like L-Carnosine (CAS 305-84-0), knowing the correct code HS universel à 6 chiffres helps avoid unnecessary delays at the border.
Always remember that regulations regarding the cosmetic ingredient hotlist change periodically. Staying updated on the legal status of ingredients in your jurisdiction is just as important as knowing the HS code. By maintaining org Cosmetic Peptides; Kyotorphin, -, YR, 98% ; LL37, Human, -, [LL-37, 37 aa], 98%.Read more anized records of your imports and understanding the technical specifications of your peptides, you ensure that your projects proceed smoothly Aug 13, 2025—List of Ingredients that are Prohibited for Use inCosmeticProducts ; 106-88-7 · 106-99-0 · 105-41-9 · 80-75-1.Read more , safely, and efficiently.