In the evolving field of molecular biology, the study of senescent cells—often colloquially referred to as "zombie" cells—has gained significant traction. Among the compounds frequently discussed in research settings is the FOXO4 DRI peptide sequence. As someone deeply interested in the mechanics of cellular biology and protein-protein interactions, I have spent significant time reviewing the available literature and technical docu FOXO4-DRI is a senolytic, retro-inverso peptidethat removes senescent cells, improves tissue function, and informs studies on aging, metabolism, and Read more mentation regarding this specific research tool.
Defining the FOXO4 DRI Peptide
The term FOXO4 DRI stands for Forkhead Box O4 D-Retro-Inverso. It is a synthetic peptide designed as a cell-permeable peptide antagonist. Its primary function in laboratory environments is to selectively disrupt the interaction between the FOXO4 transcription factor and the p53 protein.
From a structural perspective, the amino acid sequence is a critical component of its efficacy. The molecule is a D-Retro-Inverso (DRI) isoform peptide, which means the natural L-amino acid sequence has been reversed and substituted with D-amino acids to provide stability against enzymatic degradation. The core sequence is often represented as:
H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu... (extending into the functional domain).
by Y Huang·2021·Cited by 58—Recently, a senolyticpeptide, fork head box O transcription factor 4-D-Retro-Inverso (FOXO4-DRI), was reported to selectively kill the senescent fibroblasts.Read moreA common, more comprehensive representation of the sequence found in research documentation is:
H-ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg-OH.
Mechanism of Action: Why the Sequence Matters
The FOXO4-DRI is a senolytic peptide that targets p53, a crucial tumor suppressor. In healthy conditions, p53 regulates cell cycle arrest and apoptosis. How Molecular Weight: 5358.05 g/moil |Sequence: H-D-Leu-D-Thr-D-Leu-D-Arg-D Senolytic Peptide FOXO4-DRI Selectively Removes Senescent Cells From in Read more ever, in senescent cells, the interaction between FOXO4 and p53 can prevent the cell from undergoing apoptosis, allowing these cells to accumulate and potentially impact surrounding tissue function.
By utilizing this DRI peptide, researchers aim to block this specific interaction. Because FOXO4 is a pleiotropic transcription factor involved in the regul Cell-Penetrating Peptide Targets Senescent Cells to ation of a broad range of cellular pathways, its modulation is a subject of intense study. The FOXO4-DRI is a peptide acting as a specific FOXO4 blocker, designed to selectively induce apoptosis in cells that have entered senescence.
Technical Specifications and Observations
When examining the chemical properties, it is important to note that FOXO4 D-Retro-Inverso peptide acetate is often the salt form used in experimental protocols.
* Molecular Weight: Typically cited around 5358.05 g/mol to 5366.77 g/mol, depending on the specific batch and pur FOXO4 ity.
* Structure: The use of D-amino acids is what makes this a senolytic, retro-inverso peptide, ensuring that it remains active long enough to interact with its target within a laboratory setting.
* Function: FOXO4-DRI is a cell-permeable (penetrable) peptide antagonist, which is essential FOXO4-DRI is a peptide antagonistdesigned to block the interaction of forkhead box O 4 (FOXO4) and p53 [24]. Using ionizing radiation-induced senescent Read more for its ability to enter the intracellular space where the FOXO4-p53 complex resides.
Research Context and Considerations
It is widely acknowledged that Foxo4 is thought to be involved in Foxo4 is thought to be involved in cellular sencewhich refers to the lifespan of cells and cellular death as that cell ages. cellular sence (senescence), which refers to the lifespan of cells and cellular death as that cell ages. Researchers investigating this phenomenon often look for specific sequences that can intervene in these pathways.
When discussing FOXO4-DRI (15mg) or other quantities available for study, it is vital to remember these are strictly research chemicals. The FOXO4-DRI is a peptide antagonist used to gath FOXO4-DRI is a peptide antagonistdesigned to block the interaction of forkhead box O 4 (FOXO4) and p53 [24]. Using ionizing radiation-induced senescent Read more er data on protein signaling. Whether one is looking at the LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP motif or the extended sequence, the goal remains to understand the underlying biology of cellular aging and tissue regeneration.
Summary of Findings
My review of the literature confirms that the FOXO4-DRI is a D-Retro-Inverso (DRI) isoform peptide that serves as a highly specific tool for molecular biologists. The precise amino acid sequence dictates its ability to penetrate membranes and selectively interact with p53. As research continues to advance, the study of such sequences provides an essential window into the complex, "n-th order" effects of cellular interactions that define biological aging.
For those engaging with this topic, focusing on the rigorous, peer-reviewed data regarding the FOXO4-DRI is a senolytic peptide remains the best way to understand its potential in controlled, experimental environments. Always prioritize verified, high-purity sources when sourcing materials for laboratory use to ensure the integrity of the results.