In the evolving field of molecular biology, the study of senescent cells—often colloquially referred to as "zombie" cells—has gained significant traction. Among the compounds frequently discussed in research settings is the FOXO4 DRI peptide sequence. As someone deeply interested in the mechanics of cellular biology and protein-protein interactions, I have spent significant time reviewing the availabl Fox 04 DRI e literature and technical documentation regarding this specific research tool.
Defining the FOXO4 DRI Peptide
The term FOXO4 DRI stands for Forkhead Box O4 D-Retro-Inverso. It is a synthetic peptide designed as a cell-permeable peptide antagonist. Its primary function in laboratory environments is to selectively disrupt the interaction between the FOXO4 transcription factor and the p53 protein.
From a structural perspective, the amino aci Sep 4, 2024—FOXO4-DRI is a senolytic peptide that targets p53, a crucial tumor suppressor that prevents genomic mutations. Targeting p53 presents a Read more d sequence is a critical component of its efficacy. The molecule is a D-Retro-Inverso (DRI) isoform peptid They designedFOXO4-DRIto target this interaction; the 'DRI' signifies apeptidemodification called 'D-retro inverso' that reversed thesequenceof D-amino Read more e, which means the natural L-amino acid sequence has been reversed and substituted with D-amino acids to provide stability against enzymatic degradation. The core sequence is often represented as:
H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu... (extending into the functional domain).
A common, more comprehensive representation of the sequence found in research documentation is:
H-ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg-OH.
Mechanism of Action: Why the Sequence Matters
The FOXO4-DRI is a senolytic peptide that targets p53, a crucial tumor suppressor. In healthy conditions, p53 regulates cell cycle arrest and apoptosis. However, in senescent cells, the interaction between FOXO4 and p53 can prevent the cell from undergoing apoptosis, allowing these cells to accumulate and potentially impact surrounding tissue function.
By utilizing this DRI peptide, researchers aim to block this specific interaction. Because FOXO4 is a pleiotropic transcription factor involved in the regulation of a broad range of cellular pathways, its modulation is a subject of intense study. The FOXO4-DRI is a peptide acting as a specific FOXO4 blocker, designed to selectively induce apoptosis in cells that have entered senescence.
Technical Specifications and Observations
When examining the chemical properties, it is important to note that FOXO4 D-Retro-Inverso peptide acetate is often the salt form used in experimental protocols.
* Molecular Weight: Typically cited around 5358.05 g/mol to 5366.77 g/mol, depending on the specific batch and purity.
* Structure: The use of D-amino acids is what makes this a senolytic, retro-inverso peptide, ensuring that it remains active long enough to interact with its target within a laboratory setting.
* Function: FOXO4-DRI is a cell-permeable (penetrable) peptide antagonist, which is essential for its ability to enter the int FOXO4-DRI (10 mg Vial) Dosage Protocol racellular space where the FOXO4-p53 complex resides.
Research Context and Considerations
It is widely acknowledged that Foxo4 is thought to be involved in cellular sence (senescence), which refers to the lifespan of cells and cellular death as that FOXO4-DRI induces keloid senescent fibroblast apoptosis cell ages. Researchers investigating this phenomenon often look for specific sequences that can intervene in these pathways.
When discussing FOXO4-DRI (15mg) or other quantities available for study, it is vital to remember the Senolytic Peptide FOXO4-DRI Selectively Removes - PMC se are strictly research chemicals. The FOXO4-DRI is a peptide antagonist used to gather data on protein signaling. Whether one is looking at the LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP motif or the extended sequence, the goal remains to understand the underlying biology of cellular aging and tissue regeneration.
Summary of Findings
My review of the literature confirms that the FOXO4-DRI i by YX Kong·2025·Cited by 12—FOXO4-DRI peptideconsists of the followingamino acid sequencein D-Isoform: ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (Acetate Salt).Read more s a D-Retro-Inverso (DRI) isoform peptide that serves as a highly specific tool for molecular biologists. The precise amino acid sequence dictates its ability to penetrate membranes and selectively interact with p53. As research continues to advance, the study of such sequences provides an essential window into the complex, "n-th order" effects of cellular interactions that define biological aging.
For those engaging with this topic, focusing on the rigorous, peer-reviewed data regarding the FOXO4-DRI is FOXO4-DRI is a peptide acting as a specific FOXO4 blocker. It has been demonstrated to alleviate age-related testosterone secretion insufficiency.Read more a senolytic peptide remains the best way to understand its potential in controlled, experimental environments. Always prioritize verified, high-purity sources when sourcing materials for laboratory use to ensure the integrity of the results.