In the world of biochemical research and peptide analysis, few molecules command as much attention as the glucagon-like peptide GLP-2 (human) is an endogenous peptide identified as an intestinal Single Letter Sequence, HADGSFSDEMNTILDNLAARDFINWLIQTKITD. Storage, Store at -20°C.Read more 2 (GLP-2). As a user interested in the structural nuances of these compounds, I have spent considerable time examining the sequence and chemical properties that define this fascinating molecule. Whether you are reviewing literature on the GLP2R gene or exploring how glucagon-like peptide 2 (GLP-2) receptors function, understanding the primary structure is the foundational step.
The Primary Structure: Decoding the Sequence
The human glucagon-like peptide 2 is a 33-amino acid peptide, and its specific HADGSFSDEMNTILDNLAARDFINWLIQTKITD alignment is critical to its biological identification. When sourcing or analyzing this material, you will often see it represented as HADGSFSDEMNTILDNLAARDFINWLIQTKITD-OH, which highlights the terminal hydroxyl group.
For those comparing laboratory data, the single letter sequence, HADGSFSDEMNTILDNLAARDFINWLIQTKITD, is the standard nomenclature. If you are looking at the three-letter code, it begins with H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu, reflecting the specific order of residues. This unique sequence is what distinguishes it from its counterpart, GLP-1, even though both are derived from the proglucagon gene.
Comparative Analysis and Structural Context
When I look at a sequence alignment of GLP-2 and related peptides, it becomes clear why this molecule is so unique. It shares a heritage with the 29-amino-acid sequence of glucagon. In fact, researchers often discuss how GLP-2 is a newly discovered gastrointestinal peptide that operates within a complex superfamily.
It is important to note the differences between species:
* Human GLP2: Defined by the 33-residue HADGSFSDEMNTILDNLAARDFINWLIQTKITD chain.
* Mouse/Rat variants: These often show slight variations, such as at residue 11 or 19.
* GLP2: Often confused with other compounds in the GLP superfamily, it is distinct in its physiological role compared glucagon-like peptide 2 | Ligand page to the more commonly discussed GLP-1.
Technical Specifications for Research
For those involved in high-purity peptide handling, the molecular weight is approximate GLP-2 (Human) ly 3766.2 Daltons, with a molecular formula of C165H254N44O55S. When reviewing technical data, ensure the sequence: Ala. A. His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile is verified against the certificate of analysis for any sample you are evaluating.
Storage and Handling:
* Always store at -20°C or below to maintain integrity.
* Solubility is typically achieved in DMSO or 60% acetonitrile in water with 0.1% TFA.
* Glucagon-like peptide-2 - Wikipedia Purity levels should reflect >95% via HPLC to ensure the results of your sequence analysis are accurate.
Insights into the GLP2R Receptor
The interaction between the peptide and the glucagon-like peptide 2 receptor is a sophisticated mechanism mediated by G proteins, which activate adenylyl cyclase. This receptor, encoded by the GLP2R gene, is highly specific. When studying glucagon-like peptide 2 (GLP-2) receptors, it is common to see them grouped with other members of the glucagon-like peptide receptor family.
Final Thoughts on Personal Research
My personal experience with these compounds has taught me that precision is paramount. Whether A unique hormonal recognition feature of the human you are using the H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile fragment or the full-length 33-mer, verifying the sequences against established databases is essential. The complexity of these 2 related molecules continues to provide deep insights i Glucagon-like peptide-2(GLP-2) is a 33 amino acidpeptidethat is co-secreted with GLP-1 from the human intestine upon food intake.GLP-2stimulates.Read more nto biological signaling, and as long as one focuses on the verifiable, technical aspects of the peptide, the depth of knowledge available is truly immense. Always prioritize high-quality, verified documentation when working Glucagon Like Peptide 2 Receptor - an overview with these sophisticated chains.