In the by TB Wyman · 1997 · Cited by 691 — KALA/DNA (10/1)(+/-) complexes mediate transfection of a variety of cell lines. The KALA sequence provides a starting point for a family of evolving field of synthetic biochemistry, researchers often explore structural motifs that allow for unique interactions at the molecular level. Among these, the KALA peptide has garnered significant attention due to its specific structural properties and functional versatility. As someone deeply interested in laboratory-grade materials, understanding the peptide sequence and its physical characterist The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] Amino acid sequence. LL-37, 1-37 ics is essential for appreciating why it remains a subject of ongoing inquiry in biophysics.
The Structural Anatomy of KALA
The primary interest in this molecule lies in its design. KALA is an amphiphilic peptide that forms an α-helical structure at physiological pH. This capacity for conformational change is largely dictated by its primary amino acid sequence. The standard KALA peptide sequence is commonly cited by N Miura · 2017 · Cited by 19 — The KALA peptide (WEAKLAKALAKALAKHLAKALAKALKA) is an amphiphilic peptide that forms an α-helical structure at physiological pH. We previously reported that, as `WEAKLAKALAKALAKHLAKALAKALKA`.
When exploring variants, one might encounter the extended version, WEAKLAKALAKALAKHLAKALAKALK by Y Liu · 2021 · Cited by 29 — We discovered a novel peptide-HALA2 of high cellular transfection efficacy, which may act as an exciting gene delivery vector for gene therapy. ACEA, which incorporates additional residues. The inclusion of tryptophan (W) and histidine (H) within the alanine-leucine-lysine backbone is critical. These residues contribute to the molecule's ability to maintain an amphipathic nature—possessing both hydrophobic and hydrophilic faces—which is a hallmark of this peptide.
Comparative Analysis: KALA vs. Other Synthetic Peptides
To understand the specificity of KALA, it is helpful to look at other synthetic constructs. For instance, the GALA is a pH-responsive amphipathic peptide consisting of 30 amino acids. While KALA is often associated with its specific transfection properties, GALA utilizes a glutamic acid-alanine-leucine-alanine (EALA) repeat, represented by the sequence `H-Trp-Glu-Ala-Ala-Leu-Ala-Glu-Ala-Leu-Ala-Glu-Ala-Leu-Ala-Glu-His`.
Similarly, the KD20 peptide, Sequence : H-WEAALAEALAEALAEHLAEALAEALEALAA-OH, showcases how minor adjustments in the side chains can alter the overall behavior of the architecture. Furthermore, when discussing nomenclature, it is important to note that researchers often use standard one-letter amino acid codes to ensure precision. For example, when comparing these to antimicrobial motifs like LL-37, which features the sequence `[LL-37, 37 aa]`, the structural differences become clear.
Technical Applications and Observations
GALA is a pH-responsive amphipathic peptide consisting of 30 amino acids, which acts as a lung endothelium-targeting ligand. GALA undergoes a conformationalIn professional settings, the KALA peptide is often evaluated for its utility as an absorption a designed synthetic pH-responsive amphipathic peptide with enhancer. Observations suggest that KALA peptides are suitable as an absorption enhancer at specific thresholds, often noted at lower concentrations (below 1.0%, w/v).
The versatility of the molecule extends to its conjugation capabilities. Variants like CKHLAKALAKALAC demonstrate the utility of terminal cysteine residues, which allow for specific cross-linking. In many laboratory protocols, KALA/DNA (10/1)(+/-) complexes mediate transfection of a variety of cell lines, highlighting the efficiency Peptide Modifications of the charge-based interactions that these amphipathic structures facilitate.
Design Considerations in Peptide Synthesis
When synthesizing these chains, the location of functional groups is paramount. Whether a component is present at the N-terminus or the C-terminus can drastically change the binding affinity of the molecule. This is a common theme in synthetic biology, similar to how the TAT peptide (GRKKRRQRRRPQ) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus. The TAT se Linear vs Fragment SPPS for Peptide Manufacturing. As demand for complex peptide APIs reaches unprecedented scales, manufacturers face a critical strategic quence is a classic example of how specific, short sequences can influence cellular interaction.
For those working with these materials, documenting the sequence and the purity of the synthetic product is a rigorous requirement. Whether working with linear chains or cyclic structures, the goal remains the same: to utilize these highly engineered sequences to study the fundamental laws of molecular assembly and interaction in a controlled, non-clinical environment. By maintaining a focus on the structural parameters of these amphipathic molecules, we continue to refine our understanding of how these synthetic tools function in the lab.