In the world of peptide research, few molecules have garnered as much interest as the cathelicidin-derived protein known as LL 37. As someone who has spent significant time studying peptide sequences and their structural properties, I have found the complexity of this molecule fascinating. When evaluating the LL-37 peptide, it is essential to move beyond the surface and understand the fundamental biochemistry that defines its function.
The Molecular Blueprint: LL 37 Peptide Sequence
At its core, LL 37 is a 37-amino acid peptide, a fact reflected in its name. The primary sequence is defined as: [LL-37, 37 aa] This specific chain of amino acids is what gives the molecule its unique characteristics. Derived from the C-terminal region of the human cationic antimicrobial protein 18 (hCAP18), specifi LL37 (Human) cally corresponding to the 134-170 segment of human cationic antimicrobial protein 18, this molecule is the only human member of the cathelicidin family.
When I analyze the peptide LL, I am always struck by its amphipathic nature. It is widely recognized that LL-37 is the first amphipathic alpha-helical peptide isolated from human sources, which dictates how it interacts with lipid membranes and other biological surfaces.
Structural Insights and Active Domains
Research into the structural biology of this molecule has revealed a "helix-bend-helix" motif. Specifically, the structure in SDS micelles is composed of a curved amphipathic helix-bend-helix motif spanning residues 2-31, followed by a disordered C-terminal.
One of the 19 Aug 2020—Here, we demonstrate theself-assembly of the antimicrobial human LL-37 active core(residues 17-29) into a protein fibril of densely packed helices.Read more most compelling aspects of my research A member of the cathelicidin family of antimicrobial peptides. Induces FPRL-1-mediated chemotaxis of human neutrophils.Read more into this Human cathelicidin antimicrobial peptide LL-37 is the identification of its functional core. Studies have shown that residues 17-29 of LL-37 represent the active core of the antimicrobial peptide. This specific segment is critical for the self-assembly of the antimicrobial human LL-37 active core into protein fibrils of densely packed helices. This structural transition is a key area of study for anyone looking into the Anti-microbial peptide LL-37 properties.
Analyzing the Characteristics of LL-37
The molecule, often referr 23 Sept 2008—The structure ofLL-37in SDS micelles is composed of a curved amphipathic helix-bend-helix motif spanning residues 2-31 followed by a disordered C-terminal Read more ed to as LL or 37 in shorthand, exhibits a high degree of charge distribution. At physiological pH, 16 of its 37 residues are charg by OE Voronko·2025·Cited by 14—The human cathelicidinLL-37is a free amphipathicpeptidethat contains 37 amino acid residues, including 16 charged residues, resulting in a net positive Read more ed, which is instrumental in its interaction with various biological targets. Whether discussing its role as a TLR2 and TLR4 signaling inhibitor or its chemotactic properties, the LL-37 peptide remains a subject of intense scientific curiosity.
For those interested in laboratory-grade reagents, you might encounter products labeled as Rabbit Anti-LL37, which are used to detect the presence and distribution of this protein in various assays. It is impor by E Sancho-Vaello·2020·Cited by 150—Human cathelicidin comprises the cathelin precursor domain andLL-37as C-terminal extension.LL-37is activated through proteolytic cleavage as Read more tant to note that the LL-37 is a 37-amino acid peptide that requires careful handling and precise storage conditions to maintain its structural integrity, especially when evaluating its sequence-specific functions.
Summary of Findings
My journey into the biochemistry of this peptide has been enlightening. The [LL-37, 37 aa] sequence is not just a string of letters; it is a highly evolved structure capable of self-assembl Human cathelicidin antimicrobial peptide LL-37(LL-37) is an antimicrobial peptide derived from its precursor protein hCAP18, which is an only cathelicidin Read more y and complex interactions. By understanding the 134-170 segment of human cationic antimicrobial protein 18, researchers can better appreciate why this molecule is considered a foundational element in cathelicidin research.
Whether you are looking at the self-assembly of the antimicrobial human LL-37 active core or the general properties of the Anti-microbial peptide LL-37, the data consistently points to a molecule of immense structural significance. As with all peptides, the key to understanding its potential lies in the precise arrangement of its amino acids and the resulting physical properties they confer.