In the realm of biochemical research, th Antimicrobial peptide LL-37, belonging to the cathelicidin family,is the first amphipathic alpha-helical peptide isolated from human.Read more e study of endogenous host defense mechanisms has led to a profound interest in the LL-37 peptide. As a dedicated enthusiast of peptide research, I have spent significant time reviewing the structural properties and the primary sequence of this fascinating molecule. Understanding the molecular architecture is essential for anyone looking to grasp how this cathelicidin functions within biological systems.
The Molecular Architecture of the LL-37 Peptide
The LL-37 molecule is a mature peptide comprising 37 amino acids, derived from the C-terminal region of the human cationic antimicrobial protein 18 (hCAP18). When analyzing the LL-37 peptide sequence, researchers consistently reference the primary structure: [LL-37, 37 aa]
This specific chain is highly significant because it defines the molecule's unique properties. It is widely recognized as the first amphipathic alpha-helical peptide isolated The structure of the antimicrobial human cathelicidin LL-37 from human tissues. The sequence begins with two leucine residues, which is why it is designated as LL-37. The structural integrity of this protein is vital; it is often described as a curved amphipathic helix-bend-helix motif, which facilitates its interaction with various membranes.
Key Characteristics and Structural Data
When examining the human 37-amino acid chain, several technical aspects stand out:
* Molecular Weight: Approximately 4493.26 Da.
* Charge Distribution: At physiological pH, the peptide exhibits a high cationic charge due to the presence of 6 Lysine (Lys) and 5 Arginine (Arg) residues.
* Active Core: Research into the self-assembly of the antimicrobial human LL-37 active core (specifically residues 17-29) has revealed how these peptides can form fibrils of densely packed helices. This structural behavior is a cornerstone of its physical chemistry.
* Precursor Protein: It corresponds to the 134-170 segm by A Pavelka·2024·Cited by 12—LL-37 peptidehas potent antimicrobial effects against current multi-drug resistant bacterial strains. The peptide itself is also characterized Read more ent of human cationic antimicrob 5NNM: The crystal structure of dimeric LL-37 ial protein 18 (hCAP18).
Personal Observations on Peptide Research
From my personal experience in reviewing biochemical literature, LL-37 is a 37-amino acid peptide that stands out due to its versatility. While many people encounter this molecule through various online discussions—sometimes hearing that ll37 falls into a category uh of peptides that serve as a primary defense—it is crucial to maintain a focus on the data.
Whether you are The active form is LL-37, a 37 amino acid peptide having sequenceLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES. In humans, CAMP encodes the peptide precursor CAP-18 Read more investigating the Antibacterial peptide LL-37 for its potential in laboratory settings or comparing it to other sequences like those of the WLBU, the consistency of the 37-residue chain remains the gold standard for purity and identification. In my own analytical work, I have found that verifying the Cathelicidin (LL-37) sequence against known PDB entries (such as 2K6O or 5NNM) is a necessary step for ensuring the reliability of any experimental setup.
Integration of Technical Findings
The Anti-microbial peptide LL-37 continues to be a subject of intense scrutiny, not just for its primary sequence, but for how it interacts with lipid bilayers. Its amphipathic nature—possessing both hydrophobic and hydrophilic faces—allows it to integrate into surfaces effectively. Researchers often look for high-purity synthesis of the [LL-37, 37 aa] sequence to ensure that their observations regarding helical stability are accurate.
By focusing on the sequence an 2K6O: Human LL-37 Structure d the fu LL-37, Antimicrobial Peptide, human; CAS 597562-32-8 ndamental chemical properties, one can better appreciate why this molecule remains a focal point in peptide science. Whether you are exploring its role in innate immunity or its structural dynamics in synthetic environments, the precision of the LL-37 molecule is undeniable. It is a testament to the complexity of human-derived proteins and the importance of structural biology in modern research.