In the world of molecular visualization, few tools have be mCherry Antibody (NBP2-43720) come as indispensable as the mCherry peptide sequence. Having spent significant time working with various fluorescent reporters, I have found that the transition from earlier variants to this robust, monomeric red fluorescent protein (mRFP) represents a major leap in experimental reliability. When discussing the mCherry sequence, it is essential to look beyond the raw data and understand the structural nuances that make this protein a staple in modern laboratory workflows.
The Structural Blueprint of mCherry
My journey with these tools began when I first analyzed the protein sequence of mCherry. Unlike its predecessors, mCherry is defined as a red fluorescent protein that maintains a monomeric state, preventing the unwanted aggregation Dec 16, 2020—Sequence Length, Organism, Details, Image.mCherry. A. 266, Discosoma sp A. L-PEPTIDE LINKING, C16 H17 N3 O4 S, MET, TYR, GLY. Experimental Read more issues often seen with earlier DsRed derivatives. The mCherry consists of 13 beta-sheets forming a rigid beta-barrel structure, which protects the internal environment where the MCherry Protein / MCherry fluorescent protein（mCherry) chromophore resides.
The chromophore itself is a fascinating assembly of three specific amin Inserting a cDNA in the MCS downstream of themCherry coding sequencejoins your protein of interest to the C-terminus of the tag, and allows the fusion protein Read more o acids: methionine, tyrosine, and glycine. This configuration is what allows the protein to exhibit its signature red-shifted excitation and emission spectra. When reviewing the mCherry coding sequence, one can appreciate the directed evolution that led to its high photostability and brightness.
Technical Specifications and Variations
For those interested in the technical side, the mCherry protein sequence typica Recombinant mCherry protein ;Protein Sequence, MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYE GTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVM Read more lly spans 236 amino acids with a molecular mass of approximately 26.7 kDa. I have often utilized the recombinant mCherry protein (His tag) for calibration purposes, as it provides a known quantity and purity level (>97%) that is ideal for verifying imaging sensitivity.
There are several sequences and variants available for specific needs:
* mCherry-XL Sequence: A modified variant designed for specific shifts in spectral properties.
* mCherry-(CO): Often used in studies involving codon optimization to improve expression in various host organisms.
* pmCherry-N1: A popular vector architecture for creating fusion proteins, allowing the tag to be attached to the C-terminus of a target mole Application of the Fluorescent Protein mCherry to Study the cule.
Observations on Behavior and Stability
From my personal experience, the mCherry is a bright red monomeric fluorescent protein that matures rapidly. This rapid maturation is a significant advantage when time-course experiments are required, as it reduces the waiting period between expression and detectable fluorescence.
However, it is worth noting that like many specialized proteins, it can be sensitive to environmental conditions. I have observed that while it is generally stable, the mCherry mRNA and the resulting protein expression levels can vary depending on the host organism's metabolic state. It is a monomeric red fluorescent protein (mRFP) that has been further re mCherry :: Fluorescent Protein Database fined through mutations (such as N8D, K199N, T200V, and D201N) to optimize its performance.
Practical Considerations for Researchers
When integrating these tools into a study, always verify the mCherry sequence against reliable databases like NCBI. Whether you are using a standard construct or a specialized version, understanding the structural composition—including the three alpha-helices that stabilize the beta-barrel—helps in troubleshooting expression issues.
For those just starting out, remember that the mCherry excitation emission profiles are well-documented (typically Ex: 560nm / Em: 620nm). Keeping these parameters in mind ensures that your imaging setup is optimized for the specific mCherry variant you are utilizing. Whether you're working with a simple mCherry reporter or a complex fusion, the reliability of this protein remains a cornerstone of modern observation techniques.