In the realm of peptide research, the neuropeptide k sequence serves as a fascinating subject for those interested in the architecture of signaling molecules. Often referred to simply as Neuropeptide K (NPK), this molecule represe Neuropeptide K: Isolation, structure and biological activities nts a significant member of the tachykinin family. For researchers and enthusiasts tracking t by H Kotani · 1986 · Cited by 320 — The deduced amino acid sequence indicates that the bovine neuromedin K precursor (preprotachykinin B) consists of 126 amino acid residues including a he evolution of neuropeptides, understanding NPK provides a window into the complex interplay between gene expression and functional protein structure.
The Genetic Origin and Structural Composition
Neurope by K Tatemoto · 1985 · Cited by 360 — The primary structure of the peptide, designated neuropeptide K (NPK), was found to be: Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala- Leu-Tyr-Gly ptide K (NPK) is a protein encoded by the TAC1 gene, which acts as a precursor for several other well-known molecules, including substance P and neurokinin A. From a structural perspective, NPK is defined as an endogenous C-terminal extended form of neurokinin A.
When analyzing the sequence, one finds that NPK, a 36 amino acid peptide, possesses a unique arrangement. Its primary structure is represented by the string: DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM. This sequence is characterized by the presence of a conserved C-terminal region, which is a hallmark of the tachykinin superfamily—specifically the arrangement of "Phe-X-Gly Structure and gene organization of bovine neuromedin K -Leu-Met-NH2," where "X" denotes a hydrophobic residue.
For structural biologists, the PDB 2b19 data provides invaluable insights. The solution structure of this molecule reveals two well-defined helices from residues 9 to 18 and residues 27 to 33, which are connected by a noncanonical β-turn. This configuration places NPK within the Class: Alpha-helical peptides (39 superfamilies), contributing to its stability and specific binding characteristics.
Comparative Analysis and Biological Context
When comparing the neuropeptide landscape, we often look at the hierarchy of affinity. In many experimental models, the rank order of affinity for receptors is observed as: substance P > neurokinin A/substance K > ne isolated substance P (SP) from the horse intestine and elucidated the complete primary sequence as Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-amide.1 In 1983, urokinin B/neuromedin-K.
The K sequence within NPK is particularly notable because it contains the neurokinin A sequence at it PDB 2b19: Solution Structure of mammalian tachykinin peptide, Neuropeptide K | Protein Data Bank in Europe - PDBe. s C-terminus (amino acids 27–36). This structural relationship highlights the complexity of sequences derived from a single precursor. While substance P is widely recognized for its sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-amide, NPK utilizes its extended N-terminus to modulate its interaction with the environment.
Research Perspectives
For those reviewing the literature, the specific fragment H-Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu represents a critical segment often cited in biochemical studies. Whether you are looking at the foundational work of Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala- Leu-Tyr-Gly or examining modern tachykinin functions, the consistency of these structures remains a cornerstone of peptide science.
It is important to note that NPK is distinct from other tachykinin peptides like neuropeptide gamma, even though they share a common genetic lineage. The diversity found in these neuropeptides—spanning from the ancient origins of the tachykinin family to the sophisticated human TAC1 products—continues to be a primary focus for those studying molecular interactions.
As we continue to explore the neuropeptide K profile, the emphasis remains on the precise arrangement of amino acids and the resulting conformational folds. By viewing these molecules The rank order of affinity of this receptor to tachykinins is: substance P > neurokinin A/substance K > neurokinin B/neuromedin-K (PubMed:1718267). through the lens of structural biology and genetic expression, we gain a clearer picture of how these endogenous messengers are organized and how they maintain their functional integrity in various biological systems.