In the realm of peptide research, the neuropeptide k sequence serves as a fascinating subject for those interested in the architecture of signaling molecules. Often referred to simply as Neuropeptide K (NPK), this molecule represents a significant member of the tachykinin family. For researchers and enthusiasts tracking the evolution of neu by JE Petersen · 2024 · Cited by 1 — We investigate the importance of sequence differences at the bottom of the receptor orthosteric site for activity and selectivity. ropeptides, understanding NPK provides a window int by DR Nässel · 2019 · Cited by 130 — The Tac1 precursor gives rise to Substance P (SP), Neurokinin A (NKA), Neuropeptide K (NPK), and neuropeptide γ (NPγ), Tac3 to Neurokinin B (NKB), and Tac4 to o the complex interplay between gene expression and functional protein structure.
The Genetic Origin and Structural Composition
Neuropeptide K (NPK) is a protein encoded by the TAC1 gene, which acts as a precursor for several other well-known molecules, including substance P and neurokinin A. From a May 19, 2026 — This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and structural perspective, NPK is defined as an endogenous C-terminal extended form of neurokinin A.
When analyzing the sequence, one finds that NPK, a 36 amino acid peptide, possesses a unique arrangement. Its primary structure is Neuropeptide K. Not For Human Use, Lab Use Only. Cat.#: 305200. Size Sequence. H-Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu represented by the string: DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM. This sequence is characterized by the presence of a conserved C-terminal region, which is a hallmark of the tachykinin superfamily—specifically the arrangement of "Phe-X-Gly-Leu-Met-NH2," where "X" denotes a hydrophobic residue.
For structural biologists, the PDB 2b19 data provides invaluable insights. The solution structure of this molecule reveals two well-defined helices from residues 9 to 18 and residues 27 to 33, which are connected by a noncanonical β-turn. This configuration places NPK within the Class: Alpha-helical peptides (39 superfamilies), contributing to its stability and specific binding characteristics.
Comparative Analysis and Biological Context
When comparing the neuropeptide landscape, we often look at the hierarchy of affinity. In many experimental models, the rank order of affinity for receptors is observed as: substance P > neurokinin A/substance K > neurokinin B/neuromedin-K.
The K sequence within NPK is particularly notable because it contains the neurokinin A sequence at its C-terminus (amino acids 27–36). This structural relationship highlights the complexity of sequences derived from a single precursor. While substance P is widely recognized for its sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-amide, NPK utilizes its extended N-terminus to modulate its interaction with the environment.
Research Perspectives
For those reviewing the literature, the specific fragment H-Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu represents a critical segment often cited in biochemical studies. Whether you are looking at the foundational work of Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Va The global fold of NPK bound to DPC micelles consists of two well-defined helices from residues 9 to 18 and residues 27 to 33 connected by a noncanonical β l-Ala-Leu-Leu-Lys-Ala- Leu-Tyr-Gly or examining modern tachykinin functions, the consistency of these structures remains a cornerstone of peptide science.
It is important to note that NPK is distinct from other tachykinin peptides like neuropeptide gamma, even though they sha 2b19 » Neuropeptide K - OPM re a common g by PLM van Giersbergen · 1992 · Cited by 44 — Neuropeptide K (NPK) and neuropeptide γ (NPγ) are two endogenous N-terminally extended forms of neurokinin A (NKA). Here, we compared their effects with enetic lineage. The diversity found in these neuropeptides—spanning from the ancient origins of the tachykinin family to the sophisticated human TAC1 products—continues to be a primary focus for those studying molecular interactions.
As we continue to explore the neuropeptide K profile, the emphasis remains on the precise arrangement of amino acids and the resulting conformational folds. By viewing these molecules through the lens of structural biology and genetic expression, we gain a clearer picture of how these endogenous messengers are organized and how they maintain their functional integrity in various biological systems.