In the realm of peptide research, the neuropeptide k sequence serves as a fascinating subject for those interested in the architecture of signaling molecules. Often referred to simply as Neuropeptide K (NPK), this molecule represents a significant member of the tachykinin family. For researchers and enthusia Neuropeptide K sts tracking the evolution of neuropeptides, understanding NPK provides a window into the complex interplay between gen NeuroPep: a comprehensive resource of neuropeptides e expression and functional protein structure.
The Genetic Origin and Structural Compos This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and ition
Neuropeptide K (NPK) is a protein encoded by the TAC1 gene, which acts as a precursor for several other well-known molecules, including substance P and neurokinin A. From a structural perspective, NPK is define by H Kotani · 1986 · Cited by 320 — The deduced amino acid sequence indicates that the bovine neuromedin K precursor (preprotachykinin B) consists of 126 amino acid residues including a d as an Neuropeptide Y—a novel brain peptide with structural endogenous C-terminal extended form of neurokinin A.
When analyzing the sequence, one finds that NPK, a 36 amino acid peptide, possesses a unique arrangement. Its primary structure is represented by the string: DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM. This sequence is characterized by the presence of a conserved C-terminal region, which is a hallmark of the tachykinin superfamily—specifically the arrangement of "Ph Gene symbol. Gene name. Species. Precursor protein name. Synonyms. TAC1 neuropeptide K, neuropeptide gamma). Tac1, tachykinin 1, Mouse, preprotachykinin e-X-Gly-Leu-Met-NH2," where "X" denotes a hydrophobic residue.
For structural biologists, the PDB 2b19 data provides invaluable insights. The solution structure of this molecule reveals two well-defined helices from residues 9 to 18 and residues 27 to 33, which are connected by a noncanonical β-turn. This configuration places NPK within the Class: Alpha-helical peptides (39 superfamilies), contributing to its stability and specific binding characteristics.
Comparative Analysis and Biological Context
When by K Tatemoto · 1982 · Cited by 2994 — The C-terminal α-amide structure is a characteristic feature of many biologically active peptides1,2. Using a novel chemical method for the comparing the neuropeptide landscape, we often look at the hierarchy of affinity. In many experimental models, the rank order of affinity for receptors is observed as: substance P > neurokinin A/substance K > neurokinin B/neuromedin-K.
The K sequence within NPK is particularly notable because it contains the neurokinin A sequence at its C-terminus (amino acids 27–36). This structural relationship highlights the complexity of sequences derived from a single precursor. While substance P is widely recognized for its sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-amide, NPK utilizes its extended N-terminus to modulate its interaction with the environment.
Research Perspectives
For those reviewing the literature, the specific fragment H-Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu represents a critical segment often cited in biochemical studies. Whether you are looking at the foundational work of Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala- Leu-Tyr-Gly or examining modern tachykinin functions, the consistency of these structures remains a cornerstone of peptide science.
It is important to note that NPK is distinct from other tachykinin peptides like neuropeptide gamma, even though they share a common genetic lineage. The diversity found in these neuropeptides—spanning from the ancient origins of the tachykinin family to the sophisticated human TAC1 products—continues to be a primary focus for those studying molecular interactions.
As we continue to explore the neuropeptide K profile, the emphasis remains on the precise arrangement of amino acids and the resulting conformational folds. By viewing these molecules through the lens of structural biology and genetic expression, we gain a clearer picture of how these endogenous messengers are organized and how they maintain their functional integrity in various biological systems.