In the expanding field of peptide research, few molecules have garnered as much interest as peptide yy sequence variations. As someone who has spent years exploring the nuances of biochemical structures and the synthesis of amino acid chains, I have found that understanding the primary structure of these molecules is foundational to any rigorous investigation.
Color:White ; Description.Peptide YY (PYY) (3-36), human(Peptide YY (3-36)), is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.Read moreThe Structural Identity of PYY
At its core, peptide YY (often abbreviated as PYY) is a 36-residue gastrointestinal hormone. When we look at the P10082-1 isoform, which is considered the canonical sequence for *Homo sapiens*, we are observing a masterpiece This peptide is an endogenous nonselective agonist at NPY receptors. Cas No, 118997-30-1. Sequence. {TYR}{PRO}{ILE}{LYS}{PRO}{GLU}{ALA}{PRO}{GLY}{GLU}{ASP}{ALARead more of biological engineering. The sequence is defined by a specific arrangement: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2.
This peptide i by AB Leiter·1987·Cited by 86—Peptide YY is a 36-residue gastrointestinal hormonewhich inhibits both pancreatic and gastric secretion. We have isolated a cDNA encoding the peptide YY Read more s characterized by being a 36-amino acid, straight-chain polypeptide. A fascinating detail for those who analyze molecular composition is that PYY is rich in tyrosine residues located at both the amino and carboxyl terminals. This structural feature is vital, as the name "PYY" itself is derived from the "Tyr" (Tyrosine) Peptide YY. Structure of the precursor and expression in residues found at these positions.
Comparing PYY (1-36) and PYY (3-36)
In my personal experience with analytical research, identifying the difference between the full-length molecule and its truncated form is crucial.
* PYY-(1-36) represents the full-length, non-selective agonist.
* PYY3-36 is a truncated form generated by the enzyme dipeptidyl peptidase-IV.
The Peptide YY (PYY) (3-36), human variant is particularly significant in laboratory settings. Its specific sequence, IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, lacks the first two amino acids of the full-length chain. This modification shifts its activity, making it a potent neuropeptide Y2 receptor agonist. Scientific literature notes that this is a compound being evaluated for the treatment of obesity, specifically due to its influence on satiety signaling pathways.
Genetic Context and Synthesis
The PYY gene is a fascinating subject, composed of 4 exons and 3 introns. Understanding the genetics helps clarify why we see variations across species. For instance, Human PYY(1–36) differs from porcine PYY at specific positions, illustrating the evolutionary conservation within the neuropeptide Y (NPY) family.
When sourcing or synthesizing these peptides, precision is paramount. The PYY peptide YY sequence must be handled with care, typically stored at -20 °C or below to maintain integrity. The sequences are often provided in a lyophilized state, requiring careful reconsti Structural characterization of human PYY(3–36) and PYY(1 tution—usually in water at a concentration >1 mg/mL—for experimental use.
The Broader NPY Family
It is helpful to view PYY within the context of the NPY family. These peptides share a common ancestry rooted in gene duplication events. While hhY2 cDNA Peptide YY. Structure of the precursor and expression in encodes a predicted protein of 381 amino acids in some research models, the active hormone is cleaved down to the functional 36-residue form.
Whether you are studying the PYY receptor binding affinities or the structural nuances of the Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu segment, the consistency of the amino acid chain is what dictates the biological response.
Final Observations
My journey into peptide research has taught me that the devil is in the details. From the specific {TYR}{PRO}{ILE}{LYS}{PRO}{GLU}{ALA}{PRO}{GLY}{GLU}{ASP}{ALA} start of the peptide chain to the C-terminal amide group, every element of the peptide YY sequence serves a purpose. For those looking to deepen their understanding, focusing on the structural differences between PYY and its related NPY family members provides a clear, evidence-based roadmap for high-quality research.
Always ensure your documentation PYY peptide YY[ (human)]. Gene ID: 5697, updated on 3-Mar-2026. Summary. This gene encodes a member of the neuropeptide Y (NPY) family of peptides.Read more and storage protocols align with the chemical requirements of these fragile sequences to ensure the most accurate results in your personal analytical projects.