In the realm of biochemical research, few molecules have garnered as much interest as the PYY peptide sequence. As someone who follows advancements in peptide science, I have spent significant time analyzing the structural nuances that define this fascinating molecule. Whether you are exploring the properties of a peptide for laboratory study or simply curious about the underlying biology of satiety signaling, understanding the primary structure of PYY is essential.
The Structural Anatomy of PYY
At its core, PYY (Peptide YY), also known as peptide tyrosine tyrosine, is a 36-amino acid peptide. It belongs to the pancreatic polypeptide family and is encoded by the PYY gene. A defining characteristic of the molecule is that PYY is rich in tyrosine residues, which are strategically positioned at both the carboxyl- and amino-ends of the polypeptide chain.
When analyzing the sequence, it is helpful to look at the full-length human form, known as Human PYY(1–36). The canonical sequence is:
*Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2.*
This structure is highly conserved, though minor variations exist across species. For instance, researchers often compare the human sequence to porcine or rat models, where specific amino acid substitutions can influence binding affinity.
The Significance of PYY 3–36
One of the most discussed variations in current biochemical literature is PYY 3–36. This truncated form is generated by dipeptidyl peptidase-IV cleavage of the full-length peptide. From a structural perspective, PYY 3–36 lacks the first two amino acids (Tyr-Pro) of the parent molecule.
The sequence for this truncated version is:
*IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2*.
This specifi Peptide YY (PYY) c modification is highly significant because PYY (3-36) selectively binds to Y2 receptors. By focusing on this specific receptor interaction, researchers have been able to investigate how the molecule modulates biological pathways. The fact that this is a 36-amino acid peptide in its native state, but functions differently once truncated, highlights the importance of N-terminal processing in peptide activity.
Research and Analytical Context
When reviewing data on PYY 3–36, it is important to distinguish between various forms used in research. For example, you may encounter the sequence *AKPEA PeptideYY (PYY), a member of the pancreatic polypeptide family, has roles in gastric acid and pancreatic enzyme secretion and gastrointestinal motility Read more PGEDASPEELSRYYASLRHYLNLVTRQRY*, which is often identified as the porcine variant. Furthermore, studies regarding Peptide YY (PYY) gene polymorphisms in the 3'-untranslated and p Peptide YY (PYY) | Springer Nature Link roximal promoter regions have provided deeper insights into how the body regulates the expression and secretion of this peptide.
For those conducting laboratory analysis, the molecule is typically stored at -20 °C or below to maintain stability. Its solubility in water PYY (3-36) selectively binds to Y2 receptors, and it has been found in human intestine and circulating blood. Cas No, 126339-09-1. Sequence. {ILE}{LYS}{PRO Read more is generally reported as >1 mg/mL, making it a reliable subject for in vitro assays.
Bey PeptideYY (PYY) (3-36), Human ; Molecular Weight. 4049.45 ; Color. White to off-white ;SequenceShortening. IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 ; Shipping.Read more ond the Sequence: Functional Insights
The interest in PYY 3–36 extends beyond simple structural identification. It has become a focal point in discussions regarding metabolic regulation. It is worth noting that this molecule is a compound being evaluated for the treatment of obesity in various PYY Gene - GeneCards | PYY Protein | PYY Antibody research frameworks, primarily due to its role in signaling pathways that influence satiety.
When comparing this to other markers like GLP-1 or Neuropeptide Y, res Alternative Names: PYY 3-36 ; Purity: ≥95% (HPLC) ; M. Wt, 3980.4 ; Formula, C176H272N52O ; Sequence,AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY. (Modifications: Tyr-34 = C Read more earchers look for specific binding profiles. While PYY acts on multiple Y-receptors (Y1, Y2, Y4, Y5), the truncation to the 3-36 form shifts its selectivity heavily toward the Y2 receptor, which is critical for understanding its specific biological role.
Final Thoughts
Whether you are looking at the YPSKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-amide sequence of rabbit PYY or the standard human form, the preci Complete information forPYY gene(Protein Coding), Peptide YY, including: function, proteins, disorders, pathways, orthologs, and expression. sion of these amino acid chains is what makes peptide research so compelling. While products marketed as a PYY supplement or Peptide YY Supplements are often discussed in public forums, my focus remains strictly on the biochemical characterization and the structural integrity of these sequences as defined by peer-reviewed literature.
By maintaining a rigorous focus on the PYY peptide sequence, researchers can continue to unlock the complexities of how these 36-amino acid chains function within biological systems. Always ensure that any information you use for your projects is source Peptide YY (3-36): Uses, Interactions, Mechanism of Action d from reputable scientific databases like UniProt or NCBI to guarantee the accuracy of the sequences you are studying.