In the world of biochemistry and laboratory research, few molecules draw as much fascination as the teriparatide peptide sequence. As someone who has spent years exploring the structural nuances of recombinant proteins, I have found that understanding the architecture of this specific polypeptide is essential for any serious enthusiast of molecular biology.
The Architecture of the Molecule
At its core, teriparatide is defined by its precise 34-amino acid sequence. This amino acid polypeptide represents the N-terminal fragment of the native 84-amino acid human parathyroid hormone. When analyzing the peptide sequence, one immediately notices the N-terminal residues that grant this molecule its specific biological activity.
The primary sequence: H-Ser-Val-Ser-Glu-Ile-G Teriparatideis a recombinant parathyroid hormone (PTH) analog and a potent osteoanabolic agent. It is made up of the first amino(N)-terminal 34 amino acids Read more ln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH is a masterclass in structural efficiency. In my own review of laboratory data, I often refer to the shorthand notation: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF.
Technical Insights into the Sequence
When conducting teriparatide peptide mapping, researchers typically utilize high-performance liquid chromatography coupled with mass spectrometry. This allows for the verification of the amino acid sequence and ensures that the peptide has been synthesized correctly.
From a structural standpoint, the 34-amino acid sequence is fascinating because it functions as a PTH1 receptor agonist. Recent advancements, such as the Cryo-EM structure of the Teriparatide-bound human PTH1R-Gs complex, have provided unprecedented detail into how this peptide interacts with its target receptors.
Practical Observations
In the context of research, I have noted that the teriparatide CN103467595A - Method for preparing teriparatide molecule is remarkably stable when handled under correct storage conditions. The 1-12 amino acid fragment is often a focal point during synthesis, as it is critical for the conformational integrity of the molecule.
When comparing it to other substances, such as those found in the related searches (like Abaloparatide or Tirzepatide), the distinct teriparatide sequence stands out due to its specific N-terminal orientation. Whether you are looking at the molecular weight (approximately 4117. Teriparatide: Uses, Interactions, Mechanism of Action 8 Da) or the specific chemica by J Fernández-Carneado·2024·Cited by 11—Peptidemapping, UV- and MS1-based, To identify and verify primary structure.Peptide sequence, 2D-NMR (2D-TOCSY), To confirmpeptide sequence.Read more l formula (C181H291N55O51S2), it is clear that this peptide is a highly specialized tool for 7Y36: Cryo-EM structure of the Teriparatide-bound human those investigating bone cellular dynamics.
Final Thoughts on Quality
For those involved in the procurement of high-purity biochemicals, verifying the peptide sequence via analytical documentation is a standard practice. I have found that reputable suppliers provide mass spectrometry reports that confirm the identity of the 34 N-terminal amino acids, ensuring the product matches the expected profile. The precision required to maintain this specific amino acid order is what makes this peptide such a vital component in modern laboratory study.
By focusing on the integrity of the sequence, researchers can ensure that their experimental results remain consistent and verifiable, mirroring the high standards expected in the field of peptide synthesis and structural bi Teriparatide / pTH (1-34) (human) Acetate manufacturer ology.