In the world of biochemistry and laboratory research, few molecules draw as much fascination as the teriparatide peptide sequence. As someone who has spent years exploring the structural nuances of recombinant p Teriparatideis a recombinant human parathyroid hormone analog (PTH 1-34). It has an identicalsequenceto the 34 N-terminal amino acids of the 84-amino acidRead more roteins, I have found that understanding the architecture of this specific polypeptide is essential for any serious enthusiast of molecular biology.
The Architecture of the Molecule
At its core, teriparatide is defined by its precise 34-amino acid sequence. This amino acid polypeptide represents the N-terminal fragment of the native 84-amino acid human parathyroid hormone. When analyzing the peptide sequence, one immediately notices the N-terminal residues that grant this molecule its specific biological activity.
The primary sequence: H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH is a masterclass in structural efficiency. In my own review of laboratory data, I often refer to the shorthand notation: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF.
Technical Insights into the Sequence
When conducting teriparatide peptide mapping, researchers typically utilize high-performance liquid chromatography coupled with mass spectrometry. This allows for the verification of the amino acid sequence and ensures that the peptide has been synthesized correctly.
From a structural standpoint, the 34-amino acid sequence is fascinating because it functions as a PTH1 receptor agonist. Recent advancements, such as the Cryo-EM structure of the Teriparatide-bound human PTH1R-Gs complex, have provided unprecedented detail into how this peptide interacts with its target receptors.
Practical Observations
In the context of research, I have noted that the teriparatide molecule is remarkably stable when handled under correct storage conditions. The 1-12 amino acid fragment is often a focal point during synthesis, as it i Teriparatide: Uses, Interactions, Mechanism of Action s critical for the conformational integrity of the molecule.
When comparing it to other substances, such as those found in the related searches (like Aba 7Y36: Cryo-EM structure of the Teriparatide-bound human loparatide or Tirzepatide), the distinct teriparatide sequence stands out due to its specific N-terminal orientation. Whether you are looking at the molecular weight (approximately 4117.8 Da) or the specific chemical formula (C181H291N55O51S2), it is clear that this peptide is a highly specialized tool for those investigating bone cellular dynamics.
Final Thoughts on Quality
For those involved in the procurement of high-purity biochemicals, verifying the peptide sequence via analytical documentation is a standard practice. I have found that reputable suppliers provide mass spectrometry reports that confirm the identity of the 34 N-terminal amino acids, ensuring the product matches the expected profile. The precision required to maintain this specific amino acid order is what makes this peptide such a vital component in modern laborat KEGG DRUG: Teriparatide ory study.
By focusing on the integrity of the sequence, rese Teriparatide Acetate; [99294-94-7] archers can ensure that their experimental result by X Zhai·2022·Cited by 28—Teriparatide(PTH) and Abaloparatide (ABL) are terms as long-acting and short-actingpeptide, respectively, regarding their marked duration Read more s remain consistent and verifiable, mirroring the high standards expected in the field of peptide synthesis and structural biology.